Loading...
Statistics
Advertisement

Soltows Gaststätte und Partyservice | Essen außer Haus | ...
www.soltows.de/
Informationen zu Soltows Gaststätte und Partyservice

Soltows.de

Advertisement
Soltows.de is hosted in Germany . Soltows.de uses HTTPS protocol. Number of used technologies: 2. First technologies: CSS, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Soltows.de

Technology

Number of occurences: 2
  • CSS
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Soltows.de

SSL certificate

    • name: /C=US/ST=Virginia/L=Herndon/O=SWsoft, Inc./OU=Confixx/CN=confixx/emailAddress=info@confixx.com
    • subject:
      • C: US
      • ST: Virginia
      • L: Herndon
      • O: SWsoft, Inc.
      • OU: Confixx
      • CN: confixx
      • emailAddress: info@confixx.com
    • hash: 3d792800
    • issuer:
      • C: US
      • ST: Virginia
      • L: Herndon
      • O: SWsoft, Inc.
      • OU: Confixx
      • CN: confixx
      • emailAddress: info@confixx.com
    • version: 2
    • serialNumber: 9501019736119552174
    • validFrom: 081106161811Z
    • validTo: 091106161811Z
    • validFrom_time_t: 1225988291
    • validTo_time_t: 1257524291
    • extensions:
      • subjectKeyIdentifier: 3B:CD:1E:93:84:C4:DD:34:55:3F:36:9B:09:C8:57:E2:C3:8B:8E:BA
      • authorityKeyIdentifier: keyid:3B:CD:1E:93:84:C4:DD:34:55:3F:36:9B:09:C8:57:E2:C3:8B:8E:BA DirName:/C=US/ST=Virginia/L=Herndon/O=SWsoft, Inc./OU=Confixx/CN=confixx/emailAddress=info@confixx.com serial:83:DA:67:1C:87:61:A8:AE
      • basicConstraints: CA:TRUE

Meta - Soltows.de

Number of occurences: 12
  • Name: author
    Content: Gaststätte Soltow
  • Name: publisher
    Content: Gaststätte Soltow
  • Name: description
    Content: Informationen zu Soltows Gaststätte und Partyservice
  • Name: keywords
    Content: soltow, soltows, essen, frühstück, mittag, mahlzeit, abendessen, buffet, partyservice, essen, ausser, haus, außerhaus, schönberg, mecklenburg
  • Name: page-topic
    Content: Restaurant
  • Name: audience
    Content: Alle
  • Name: expires
    Content: NEVER
  • Name: page-type
    Content: Private Homepage
  • Name: robots
    Content: INDEX,FOLLOW
  • Name: lang
    Content: de, at, ch
  • Name: revisit-after
    Content: 30 days
  • Name:
    Content: text/html; charset=iso-8859-1

Server / Hosting

  • IP: 95.130.250.70
  • Latitude: 51.30
  • Longitude: 9.49
  • Country: Germany

Rname

  • ns1.procredo.de
  • ns4.procredo.de
  • ns3.procredo.de
  • ns2.procredo.de
  • ns5.procredo.de
  • www10.tibit.de

Target

  • info.ewa-productions.de

HTTP Header Response

HTTP/1.1 200 OK Date: Sat, 20 Aug 2016 01:23:43 GMT Server: Apache Last-Modified: Sun, 04 Jan 2015 23:00:00 GMT ETag: "18a032c-1407-50bdb88895c00" Accept-Ranges: bytes Content-Length: 5127 Vary: Accept-Encoding Content-Type: text/html X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive

DNS

host: soltows.de
  1. class: IN
  2. ttl: 86400
  3. type: A
  4. ip: 95.130.250.70
host: soltows.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.procredo.de
host: soltows.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns4.procredo.de
host: soltows.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.procredo.de
host: soltows.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.procredo.de
host: soltows.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns5.procredo.de
host: soltows.de
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.procredo.de
  5. rname: info.ewa-productions.de
  6. serial: 2011051102
  7. refresh: 39940
  8. retry: 14400
  9. expire: 604800
  10. minimum-ttl: 86400
host: soltows.de
  1. class: IN
  2. ttl: 360
  3. type: MX
  4. pri: 10
  5. target: www10.tibit.de

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.oltows.de, www.seoltows.de, www.eoltows.de, www.swoltows.de, www.woltows.de, www.sdoltows.de, www.doltows.de, www.sxoltows.de, www.xoltows.de, www.sfoltows.de, www.foltows.de, www.sgoltows.de, www.goltows.de, www.stoltows.de, www.toltows.de, www.sltows.de, www.sobltows.de, www.sbltows.de, www.sohltows.de, www.shltows.de, www.sogltows.de, www.sgltows.de, www.sojltows.de, www.sjltows.de, www.somltows.de, www.smltows.de, www.so ltows.de, www.s ltows.de, www.sovltows.de, www.svltows.de, www.sotows.de, www.solutows.de, www.soutows.de, www.sol8tows.de, www.so8tows.de, www.sol9tows.de, www.so9tows.de, www.soljtows.de, www.sojtows.de, www.sol0tows.de, www.so0tows.de, www.solmtows.de, www.somtows.de, www.solptows.de, www.soptows.de, www.solotows.de, www.sootows.de, www.solows.de, www.soltqows.de, www.solqows.de, www.soltaows.de, www.solaows.de, www.solt ows.de, www.sol ows.de, www.soltwows.de, www.solwows.de, www.solteows.de, www.soleows.de, www.soltzows.de, www.solzows.de, www.soltxows.de, www.solxows.de, www.soltcows.de, www.solcows.de, www.soltws.de, www.soltobws.de, www.soltbws.de, www.soltohws.de, www.solthws.de, www.soltogws.de, www.soltgws.de, www.soltojws.de, www.soltjws.de, www.soltomws.de, www.soltmws.de, www.solto ws.de, www.solt ws.de, www.soltovws.de, www.soltvws.de, www.soltos.de, www.soltow s.de, www.solto s.de, www.soltowcs.de, www.soltocs.de, www.soltows.de, www.soltos.de, www.soltowds.de, www.soltods.de, www.soltowfs.de, www.soltofs.de, www.soltowgs.de, www.soltogs.de, www.soltowbs.de, www.soltobs.de, www.soltow.de, www.soltowse.de, www.soltowe.de, www.soltowsw.de, www.soltoww.de, www.soltowsd.de, www.soltowd.de, www.soltowsx.de, www.soltowx.de, www.soltowsf.de, www.soltowf.de, www.soltowsg.de, www.soltowg.de, www.soltowst.de, www.soltowt.de,

Other websites we recently analyzed

  1. Welcome to BESTRESTAURANTSINKEYWEST.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 1
  2. OUTROXTREME
    Korea, Republic of - 183.111.174.8
    Server software: nginx
    Technology: CSS, Html
    Number of meta tags: 1
  3. Leonardo Almeida | Sposen Realty & Development
    San Antonio (United States) - 67.192.7.83
    Server software: Apache
    Technology: Maxcdn, OSS CDN, CSS, Flexslider, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cycle, jQuery Validate, jQuery UI, Php, Pingback, Wordpress
    Number of Javascript: 38
    Number of meta tags: 3
  4. 63355.xyz
    San Jose (United States) - 23.27.192.115
    Server software: Tengine/1.4.2
    Technology: CloudFront, Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  5. virgingalacticspaceflightsystems.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  6. cheaplouboutinsssstores.com
    Switzerland - 141.8.225.181
    Server software: nginx/1.9.2
    Technology: Html
  7. ITAIM KEIKO - Longevidade no Esporte Tênis de Mesa
    Academia de Tênis de Mesa Especializada
    Houston (United States) - 192.185.217.48
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Javascript
    Number of Javascript: 12
    Number of meta tags: 5
  8. petalumahomesonline.com
    Scottsdale (United States) - 184.168.221.61
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  9. Intro
    Berlin (Germany) - 81.169.145.151
    Server software: Apache/2.2.31 (Unix)
    Technology: Html
    Number of meta tags: 1
  10. www.superbugs.tv
    Ashburn (United States) - 52.0.217.44
    Server software:
    Technology: CSS, Html, Javascript
    Number of Javascript: 2
    Number of meta tags: 2

Check Other Websites